Lineage for d1pax_2 (1pax 797-1011)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.166: ADP-ribosylation [56398] (1 superfamily) Superfamily d.166.1: ADP-ribosylation [56399] (2 families) 
Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (1 protein) Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [56418] (7 PDB entries) 
Domain d1pax_2: 1pax 797-1011 [42278]
Other proteins in same PDB: d1pax_1
Details for d1pax_2
PDB Entry: 1pax (more details), 2.4 Å
PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with 3,4-dihydro-5-methyl-isoquinolinone
SCOP Domain Sequences for d1pax_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pax_2 d.166.1.2 (797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus)}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfnykt
SCOP Domain Coordinates for d1pax_2:
Click to download the PDB-style file with coordinates for d1pax_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pax_2:
- d1pax_2 appears in SCOP 1.57
- d1pax_2 appears in the current release, SCOPe 2.08, called d1paxa2
View in 3D
