SCOP 1.65: Domain d3pax_2: 3pax 797-1011

Lineage for d3pax_2 (3pax 797-1011)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (3 families)

5. Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (1 protein)

6. Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56418] (7 PDB entries)

8. Domain d3pax_2: 3pax 797-1011 [42277]
   Other proteins in same PDB: d3pax_1
   complexed with 3mb

Details for d3pax_2

PDB Entry: 3pax, 2.4 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with 3-methoxybenzamide

SCOP Domain Sequences for d3pax_2:

Sequence; same for both SEQRES and ATOM records:

>d3pax_2 d.166.1.2 (797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus)}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfnykt

Timeline for d3pax_2:

• d3pax_2 first appeared (with stable ids) in SCOP 1.55
  
• d3pax_2 appears in SCOP 1.63
  
• d3pax_2 appears in SCOP 1.67
  
• d3pax_2 appears in the current release, SCOPe 2.08, called d3paxa2