SCOP 1.65: Domain d2pax_2: 2pax 797-1011

Lineage for d2pax_2 (2pax 797-1011)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (3 families)

5. Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (1 protein)

6. Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56418] (7 PDB entries)

8. Domain d2pax_2: 2pax 797-1011 [42276]
   Other proteins in same PDB: d2pax_1
   complexed with 4an

Details for d2pax_2

PDB Entry: 2pax, 2.4 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with 4-amino-1,8-naphthalimide

SCOP Domain Sequences for d2pax_2:

Sequence; same for both SEQRES and ATOM records:

>d2pax_2 d.166.1.2 (797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus)}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfnykt

Timeline for d2pax_2:

• d2pax_2 first appeared (with stable ids) in SCOP 1.55
  
• d2pax_2 appears in SCOP 1.63
  
• d2pax_2 appears in SCOP 1.67
  
• d2pax_2 appears in the current release, SCOPe 2.08, called d2paxa2