SCOPe 2.05: Domain d1efya2: 1efy A:797-1011

Lineage for d1efya2 (1efy A:797-1011)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
   automatically mapped to Pfam PF00644

6. Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [56418] (7 PDB entries)

8. Domain d1efya2: 1efy A:797-1011 [42275]
   Other proteins in same PDB: d1efya1
   complexed with bzc

Details for d1efya2

PDB Entry: 1efy, 2.2 Å

PDB Description: crystal structure of the catalytic fragment of poly (adp-ribose) polymerase complexed with a benzimidazole inhibitor

PDB Compounds: (A:) poly (ADP-ribose) polymerase

SCOPe Domain Sequences for d1efya2:

Sequence; same for both SEQRES and ATOM records:

>d1efya2 d.166.1.2 (A:797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfnykt

Timeline for d1efya2:

• d1efya2 first appeared (with stable ids) in SCOP 1.55
  
• d1efya2 appears in SCOPe 2.04
  
• d1efya2 appears in SCOPe 2.06
  
• d1efya2 appears in the current release, SCOPe 2.08