Lineage for d1efya2 (1efy A:797-1011)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37191Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 37192Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 37254Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (1 protein)
  6. 37255Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (1 species)
  7. 37256Species Chicken (Gallus gallus) [TaxId:9031] [56418] (7 PDB entries)
  8. 37258Domain d1efya2: 1efy A:797-1011 [42275]
    Other proteins in same PDB: d1efya1

Details for d1efya2

PDB Entry: 1efy (more details), 2.2 Å

PDB Description: crystal structure of the catalytic fragment of poly (adp-ribose) polymerase complexed with a benzimidazole inhibitor

SCOP Domain Sequences for d1efya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efya2 d.166.1.2 (A:797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus)}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfnykt

SCOP Domain Coordinates for d1efya2:

Click to download the PDB-style file with coordinates for d1efya2.
(The format of our PDB-style files is described here.)

Timeline for d1efya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1efya1