Lineage for d1efya2 (1efy A:797-1011)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [56418] (7 PDB entries)
  8. Domain d1efya2: 1efy A:797-1011 [42275]
    Other proteins in same PDB: d1efya1
    complexed with bzc

Details for d1efya2

PDB Entry: 1efy (more details), 2.2 Å

PDB Description: crystal structure of the catalytic fragment of poly (adp-ribose) polymerase complexed with a benzimidazole inhibitor
PDB Compounds: (A:) poly (ADP-ribose) polymerase

SCOPe Domain Sequences for d1efya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efya2 d.166.1.2 (A:797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfnykt

SCOPe Domain Coordinates for d1efya2 are not available.

Timeline for d1efya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1efya1