Lineage for d1a26a2 (1a26 A:797-1012)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234080Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 2234081Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. 2234082Species Chicken (Gallus gallus) [TaxId:9031] [56418] (7 PDB entries)
  8. 2234083Domain d1a26a2: 1a26 A:797-1012 [42274]
    Other proteins in same PDB: d1a26a1
    complexed with cna

Details for d1a26a2

PDB Entry: 1a26 (more details), 2.25 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with carba-nad
PDB Compounds: (A:) poly (ADP-ribose) polymerase

SCOPe Domain Sequences for d1a26a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a26a2 d.166.1.2 (A:797-1012) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfnykts

SCOPe Domain Coordinates for d1a26a2:

Click to download the PDB-style file with coordinates for d1a26a2.
(The format of our PDB-style files is described here.)

Timeline for d1a26a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a26a1