Lineage for d1a26_2 (1a26 797-1012)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336523Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 336524Superfamily d.166.1: ADP-ribosylation [56399] (3 families) (S)
  5. 336609Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (1 protein)
  6. 336610Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (2 species)
  7. 336611Species Chicken (Gallus gallus) [TaxId:9031] [56418] (7 PDB entries)
  8. 336612Domain d1a26_2: 1a26 797-1012 [42274]
    Other proteins in same PDB: d1a26_1
    complexed with cna

Details for d1a26_2

PDB Entry: 1a26 (more details), 2.25 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with carba-nad

SCOP Domain Sequences for d1a26_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a26_2 d.166.1.2 (797-1012) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus)}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfnykts

SCOP Domain Coordinates for d1a26_2:

Click to download the PDB-style file with coordinates for d1a26_2.
(The format of our PDB-style files is described here.)

Timeline for d1a26_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a26_1