Lineage for d1a26_2 (1a26 797-1012)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.166: ADP-ribosylation [56398] (1 superfamily) Superfamily d.166.1: ADP-ribosylation [56399] (2 families) 
Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (1 protein) Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [56418] (7 PDB entries) 
Domain d1a26_2: 1a26 797-1012 [42274]
Other proteins in same PDB: d1a26_1
Details for d1a26_2
PDB Entry: 1a26 (more details), 2.25 Å
PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with carba-nad
SCOP Domain Sequences for d1a26_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a26_2 d.166.1.2 (797-1012) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus)}
lrtdikvvdkdseeakiikqyvknthaathnaydlkvveifrieregesqrykpfkqlhn
rqllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqadpi
glillgevalgnmyelknashitklpkgkhsvkglgktapdptatttldgvevplgngis
tgindtcllyneyivydvaqvnlkyllklkfnykts
SCOP Domain Coordinates for d1a26_2:
Click to download the PDB-style file with coordinates for d1a26_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a26_2:
- d1a26_2 first appeared (with stable ids) in SCOP 1.55
- d1a26_2 appears in SCOP 1.59
- d1a26_2 appears in the current release, SCOPe 2.08, called d1a26a2
View in 3D
