Lineage for d1g24c_ (1g24 C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85464Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 85465Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 85466Family d.166.1.1: ADP-ribosylating toxins [56400] (7 proteins)
  6. 85482Protein Exoenzyme c3 [56414] (1 species)
  7. 85483Species Clostridium botulinum [56415] (1 PDB entry)
  8. 85486Domain d1g24c_: 1g24 C: [42272]

Details for d1g24c_

PDB Entry: 1g24 (more details), 1.7 Å

PDB Description: the crystal structure of exoenzyme c3 from clostridium botulinum

SCOP Domain Sequences for d1g24c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g24c_ d.166.1.1 (C:) Exoenzyme c3 {Clostridium botulinum}
aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
styhiddmrlssdgkqiiitatmmgtainpk

SCOP Domain Coordinates for d1g24c_:

Click to download the PDB-style file with coordinates for d1g24c_.
(The format of our PDB-style files is described here.)

Timeline for d1g24c_: