Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins) |
Protein Methionine gamma-lyase, MGL [64126] (4 species) |
Species Pseudomonas putida [TaxId:303] [75271] (15 PDB entries) Uniprot P13254 |
Domain d7f1vc_: 7f1v C: [422719] automated match to d1ukja_ complexed with 7xf, hcs, llp; mutant |
PDB Entry: 7f1v (more details), 2.25 Å
SCOPe Domain Sequences for d7f1vc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7f1vc_ c.67.1.3 (C:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} lpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfysrisnpt lnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlygctfaflhhgig efgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhgatvvvd ntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglkdmtgav lsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqytlarqq msqpggmiafelkggigagrrfmnalqlfsravslgdaeslashpasmthssytpeerah ygiseglvrlsvglediddlladvqqalkasa
Timeline for d7f1vc_: