Lineage for d1g24b_ (1g24 B:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37191Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 37192Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 37193Family d.166.1.1: ADP-ribosylating toxins [56400] (7 proteins)
  6. 37209Protein Exoenzyme c3 [56414] (1 species)
  7. 37210Species Clostridium botulinum [56415] (1 PDB entry)
  8. 37212Domain d1g24b_: 1g24 B: [42271]

Details for d1g24b_

PDB Entry: 1g24 (more details), 1.7 Å

PDB Description: the crystal structure of exoenzyme c3 from clostridium botulinum

SCOP Domain Sequences for d1g24b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g24b_ d.166.1.1 (B:) Exoenzyme c3 {Clostridium botulinum}
aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
styhiddmrlssdgkqiiitatmmgtainpk

SCOP Domain Coordinates for d1g24b_:

Click to download the PDB-style file with coordinates for d1g24b_.
(The format of our PDB-style files is described here.)

Timeline for d1g24b_: