Lineage for d1g24b_ (1g24 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000485Protein Exoenzyme c3 [56414] (4 species)
  7. 3000493Species Clostridium botulinum [TaxId:1491] [56415] (6 PDB entries)
    Uniprot P15879 41-251
  8. 3000495Domain d1g24b_: 1g24 B: [42271]

Details for d1g24b_

PDB Entry: 1g24 (more details), 1.7 Å

PDB Description: the crystal structure of exoenzyme c3 from clostridium botulinum
PDB Compounds: (B:) exoenzyme c3

SCOPe Domain Sequences for d1g24b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g24b_ d.166.1.1 (B:) Exoenzyme c3 {Clostridium botulinum [TaxId: 1491]}
aysntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingf
psnlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekaka
kflnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagqlemllprh
styhiddmrlssdgkqiiitatmmgtainpk

SCOPe Domain Coordinates for d1g24b_:

Click to download the PDB-style file with coordinates for d1g24b_.
(The format of our PDB-style files is described here.)

Timeline for d1g24b_: