Lineage for d1qs1d1 (1qs1 D:3060-3264)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606368Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2606369Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2606370Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 2606500Protein Vegetative insecticidal protein 2 (VIP2) [56412] (1 species)
    duplication: consists of two domains of this fold, the second of which is catalytic
  7. 2606501Species Bacillus cereus [TaxId:1396] [56413] (2 PDB entries)
  8. 2606508Domain d1qs1d1: 1qs1 D:3060-3264 [42266]

Details for d1qs1d1

PDB Entry: 1qs1 (more details), 1.5 Å

PDB Description: crystal structure of vegetative insecticidal protein2 (vip2)
PDB Compounds: (D:) ADP-ribosyltransferase

SCOPe Domain Sequences for d1qs1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qs1d1 d.166.1.1 (D:3060-3264) Vegetative insecticidal protein 2 (VIP2) {Bacillus cereus [TaxId: 1396]}
tdkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsf
edeikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfld
rdikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngym
vhvdkvskvvkkgveclqiegtlkk

SCOPe Domain Coordinates for d1qs1d1:

Click to download the PDB-style file with coordinates for d1qs1d1.
(The format of our PDB-style files is described here.)

Timeline for d1qs1d1: