SCOPe 2.08: Domain d7p0td1: 7p0t D:1-181

Lineage for d7p0td1 (7p0t D:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries)

8. Domain d7p0td1: 7p0t D:1-181 [422652]
   Other proteins in same PDB: d7p0ta2, d7p0tb_, d7p0td2, d7p0te_
   automated match to d1n5aa2
   complexed with cl, so4

Details for d7p0td1

PDB Entry: 7p0t, 2.61 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 peptide with d- aminoacid

PDB Compounds: (D:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d7p0td1:

Sequence, based on SEQRES records:

>d7p0td1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Sequence, based on observed residues (ATOM records):

>d7p0td1 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylknr

Timeline for d7p0td1:

• d7p0td1 is new in SCOPe 2.08-stable