Lineage for d7p0tb_ (7p0t B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2745638Protein beta2-microglobulin [88600] (7 species)
  7. 2746421Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 3086331Domain d7p0tb_: 7p0t B: [422648]
    Other proteins in same PDB: d7p0ta1, d7p0ta2, d7p0td1, d7p0td2
    automated match to d6lb2b_
    complexed with cl, so4

Details for d7p0tb_

PDB Entry: 7p0t (more details), 2.61 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 peptide with d- aminoacid
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d7p0tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7p0tb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d7p0tb_:

Click to download the PDB-style file with coordinates for d7p0tb_.
(The format of our PDB-style files is described here.)

Timeline for d7p0tb_:

  • d7p0tb_ is new in SCOPe 2.08-stable