![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (3 families) ![]() |
![]() | Family d.166.1.1: ADP-ribosylating toxins [56400] (9 proteins) |
![]() | Protein Vegetative insecticidal protein 2 (VIP2) [56412] (1 species) duplication: consists of two domains of this fold, the second of which is catalytic |
![]() | Species Bacillus cereus [TaxId:1396] [56413] (2 PDB entries) |
![]() | Domain d1qs1c1: 1qs1 C:2060-2264 [42264] |
PDB Entry: 1qs1 (more details), 1.5 Å
SCOP Domain Sequences for d1qs1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qs1c1 d.166.1.1 (C:2060-2264) Vegetative insecticidal protein 2 (VIP2) {Bacillus cereus} tdkvedfkedkekakewgkekekewkltatekgkmnnfldnkndiktnykeitfsmagsf edeikdlkeidkmfdktnlsnsiityknvepttigfnksltegntinsdamaqfkeqfld rdikfdsyldthltaqqvsskervilkvtvpsgkgsttptkagvilnnseykmlidngym vhvdkvskvvkkgveclqiegtlkk
Timeline for d1qs1c1: