SCOPe 2.08: Domain d7s2sd1: 7s2s D:32-129

Lineage for d7s2sd1 (7s2s D:32-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)

8. Domain d7s2sd1: 7s2s D:32-129 [422626]
   automated match to d4gs7b1
   complexed with so4

Details for d7s2sd1

PDB Entry: 7s2s, 1.93 Å

PDB Description: nanobody bound to interleukin-2rbeta

PDB Compounds: (D:) Interleukin-2 receptor subunit beta

SCOPe Domain Sequences for d7s2sd1:

Sequence; same for both SEQRES and ATOM records:

>d7s2sd1 b.1.2.1 (D:32-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraniscvwsqdgalqdtscqvhawpdrrrwnqtcellpvsqaswacnlilg
apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfen

Timeline for d7s2sd1:

• d7s2sd1 is new in SCOPe 2.08-stable