Lineage for d1xtc.1 (1xtc A:,C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37191Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 37192Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 37193Family d.166.1.1: ADP-ribosylating toxins [56400] (7 proteins)
  6. 37194Protein Cholera toxin [56410] (1 species)
  7. 37195Species Vibrio cholerae [TaxId:666] [56411] (1 PDB entry)
  8. 37196Domain d1xtc.1: 1xtc A:,C: [42259]
    Other proteins in same PDB: d1xtcd_, d1xtce_, d1xtcf_, d1xtcg_, d1xtch_

Details for d1xtc.1

PDB Entry: 1xtc (more details), 2.4 Å

PDB Description: cholera toxin

SCOP Domain Sequences for d1xtc.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1xtc.1 d.166.1.1 (A:,C:) Cholera toxin {Vibrio cholerae}
nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
stsislrsahlvgqtilsghstyylyvlatapnmfnvndvlgaysphpdeqevsalggip
ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
hhappgcgnaprXsntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel

SCOP Domain Coordinates for d1xtc.1:

Click to download the PDB-style file with coordinates for d1xtc.1.
(The format of our PDB-style files is described here.)

Timeline for d1xtc.1: