Lineage for d7vvah_ (7vva H:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904712Species Escherichia coli [TaxId:562] [188596] (5 PDB entries)
  8. 3086263Domain d7vvah_: 7vva H: [422580]
    automated match to d3kzha_
    complexed with fjf

Details for d7vvah_

PDB Entry: 7vva (more details), 2.75 Å

PDB Description: pseudouridine bound structure of pseudouridine kinase (puki) from escherichia coli strain b
PDB Compounds: (H:) Pseudouridine kinase

SCOPe Domain Sequences for d7vvah_:

Sequence, based on SEQRES records: (download)

>d7vvah_ c.72.1.0 (H:) automated matches {Escherichia coli [TaxId: 562]}
dyvviigsanidvagysheslnyadsnpgkikftpggvgrniaqnlallgnkawllsavg
sdfygqslltqtnqsgvyvdkclivpgentssylslldntgemlvaindmnisnaitaey
laqhrefiqrakvivadcniseealawild

Sequence, based on observed residues (ATOM records): (download)

>d7vvah_ c.72.1.0 (H:) automated matches {Escherichia coli [TaxId: 562]}
dyvviigsanidvagysheslnyadsnpgkikftpggvgrniaqlallgnkawllsavgs
dfygqslltqtnqsvyvdkclivpgentssylslldlvaindmnisnaitaeylaqhref
ikvivadcniseealawild

SCOPe Domain Coordinates for d7vvah_:

Click to download the PDB-style file with coordinates for d7vvah_.
(The format of our PDB-style files is described here.)

Timeline for d7vvah_:

  • d7vvah_ is new in SCOPe 2.08-stable