![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
![]() | Protein automated matches [190498] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187723] (2 PDB entries) |
![]() | Domain d7o0ca_: 7o0c A: [422554] automated match to d2q4ra_ complexed with cl, mg, na |
PDB Entry: 7o0c (more details), 2.8 Å
SCOPe Domain Sequences for d7o0ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7o0ca_ c.108.1.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gpalclfdvdgtltaprqkitkemddflqklrqkikigvvggsdfekvqeqlgndvveky dyvfpenglvaykdgkllcrqniqshlgealiqdlinyclsyiakiklpkkrgtfiefrn gmlnvspigrscsqeeriefyeldkkenirqkfvadlrkefagkgltfsiggqisfdvfp dgwdkryclrhvendgyktiyffgdktmpggndheiftdprtmgysvtapedtrricell fs
Timeline for d7o0ca_: