SCOPe 2.08: Domain d7o0ca_: 7o0c A:

Lineage for d7o0ca_ (7o0c A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein automated matches [190498] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187723] (2 PDB entries)

8. Domain d7o0ca_: 7o0c A: [422554]
   automated match to d2q4ra_
   complexed with cl, mg, na

Details for d7o0ca_

PDB Entry: 7o0c, 2.8 Å

PDB Description: human phosphomannomutase 2 (pmm2) wild-type in apo state

PDB Compounds: (A:) Phosphomannomutase 2

SCOPe Domain Sequences for d7o0ca_:

Sequence; same for both SEQRES and ATOM records:

>d7o0ca_ c.108.1.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpalclfdvdgtltaprqkitkemddflqklrqkikigvvggsdfekvqeqlgndvveky
dyvfpenglvaykdgkllcrqniqshlgealiqdlinyclsyiakiklpkkrgtfiefrn
gmlnvspigrscsqeeriefyeldkkenirqkfvadlrkefagkgltfsiggqisfdvfp
dgwdkryclrhvendgyktiyffgdktmpggndheiftdprtmgysvtapedtrricell
fs

Timeline for d7o0ca_:

• d7o0ca_ is new in SCOPe 2.08-stable