Class a: All alpha proteins [46456] (290 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Mitochondrial cytochrome c [46642] (7 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (92 PDB entries) Uniprot P00044 |
Domain d7pr3d_: 7pr3 D: [422511] automated match to d5t8wa_ complexed with 80m, hec, po4, zn |
PDB Entry: 7pr3 (more details), 2.37 Å
SCOPe Domain Sequences for d7pr3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7pr3d_ a.3.1.1 (D:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} efkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikkn vlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate
Timeline for d7pr3d_: