Lineage for d7ppsa1 (7pps A:1-249)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 3086175Species Pseudomonas aeruginosa [TaxId:208963] [422492] (1 PDB entry)
  8. 3086189Domain d7ppsa1: 7pps A:1-249 [422506]
    automated match to d3mqda1
    complexed with cl, edo, iod; mutant

Details for d7ppsa1

PDB Entry: 7pps (more details), 1.3 Å

PDB Description: apo fabb from pseudomonas aeruginosa with single point mutation c161a
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d7ppsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ppsa1 c.95.1.0 (A:1-249) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
mrrvvitglgivsclgndkdtvsanlragrpgirfnpsyaemglrshvsgsvdlnleeli
drkvfrfmgdaaayaylameqaikdsgltpeqisnprtgliagsggastlnqmeaidtlr
ekgvkrigpyrvtrtmgstvsaclatpfqikgvnysissaaatsahcigqameqiqlgkq
dvvfagggeeehwsqsclfdamgalstqynetpekasraydakrdgfviaggggmvvvee
lehalkrga

SCOPe Domain Coordinates for d7ppsa1:

Click to download the PDB-style file with coordinates for d7ppsa1.
(The format of our PDB-style files is described here.)

Timeline for d7ppsa1:

  • d7ppsa1 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7ppsa2