Lineage for d1aerb_ (1aer B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198546Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 198547Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 198548Family d.166.1.1: ADP-ribosylating toxins [56400] (8 proteins)
  6. 198575Protein Exotoxin A, C-terminal domain [56406] (1 species)
  7. 198576Species Pseudomonas aeruginosa [TaxId:287] [56407] (4 PDB entries)
  8. 198580Domain d1aerb_: 1aer B: [42250]

Details for d1aerb_

PDB Entry: 1aer (more details), 2.3 Å

PDB Description: domain iii of pseudomonas aeruginosa exotoxin complexed with beta-tad

SCOP Domain Sequences for d1aerb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aerb_ d.166.1.1 (B:) Exotoxin A, C-terminal domain {Pseudomonas aeruginosa}
flgdggdvsfstrgtqnwtverllqahrqleergyvfvgyhgtfleaaqsivfggvrars
qdldaiwrgfyiagdpalaygyaqdqepdrgrirngallrvyvprsslpgfyrtsltlaa
peaageverlighplplrldaitgprletilgwplaertvvipsaiptdprnvggdldps
sipdkeqaisalpdy

SCOP Domain Coordinates for d1aerb_:

Click to download the PDB-style file with coordinates for d1aerb_.
(The format of our PDB-style files is described here.)

Timeline for d1aerb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aera_