Lineage for d1dtp__ (1dtp -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37191Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 37192Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 37193Family d.166.1.1: ADP-ribosylating toxins [56400] (7 proteins)
  6. 37197Protein Diphtheria toxin, N-terminal domain [56404] (1 species)
  7. 37198Species Corynebacterium diphtheriae [TaxId:1717] [56405] (7 PDB entries)
  8. 37208Domain d1dtp__: 1dtp - [42248]

Details for d1dtp__

PDB Entry: 1dtp (more details), 2.5 Å

PDB Description: the structure of the isolated catalytic domain of diphtheria toxin

SCOP Domain Sequences for d1dtp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtp__ d.166.1.1 (-) Diphtheria toxin, N-terminal domain {Corynebacterium diphtheriae}
gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
ymaqacagnr

SCOP Domain Coordinates for d1dtp__:

Click to download the PDB-style file with coordinates for d1dtp__.
(The format of our PDB-style files is described here.)

Timeline for d1dtp__: