Lineage for d1dtpa_ (1dtp A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. Protein Diphtheria toxin, N-terminal domain [56404] (1 species)
  7. Species Corynebacterium diphtheriae [TaxId:1717] [56405] (8 PDB entries)
  8. Domain d1dtpa_: 1dtp A: [42248]
    one domain only
    complexed with apu

Details for d1dtpa_

PDB Entry: 1dtp (more details), 2.5 Å

PDB Description: the structure of the isolated catalytic domain of diphtheria toxin
PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d1dtpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtpa_ d.166.1.1 (A:) Diphtheria toxin, N-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]}
gaddvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkgfystdnky
daagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgt
eefikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamye
ymaqacagnr

SCOPe Domain Coordinates for d1dtpa_ are not available.

Timeline for d1dtpa_: