SCOPe 2.08: Domain d5scta1: 5sct A:1-159

Lineage for d5scta1 (5sct A:1-159)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [53602] (24 PDB entries)

8. Domain d5scta1: 5sct A:1-159 [422421]
   Other proteins in same PDB: d5scta2
   automated match to d6ddwa_
   complexed with h03, nap

Details for d5scta1

PDB Entry: 5sct, 1.55 Å

PDB Description: crystal structure of dihydrofolate reductase from mycobacterium tuberculosis bound to nadp and sddc inhibitor sddc-783

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d5scta1:

Sequence; same for both SEQRES and ATOM records:

>d5scta1 c.71.1.1 (A:1-159) Dihydrofolate reductase, prokaryotic type {Mycobacterium tuberculosis [TaxId: 1773]}
mvgliwaqatsgvigrggdipwrlpedqahfreitmghtivmgrrtwdslpakvrplpgr
rnvvlsrqadfmasgaevvgsleealtspetwvigggqvyalalpyatrcevtevdiglp
reagdalapvldetwrgetgewrfsrsglryrlysyhrs

Timeline for d5scta1:

• d5scta1 is new in SCOPe 2.08-stable