Lineage for d7phvc_ (7phv C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754067Species Chicken (Gallus gallus) [TaxId:9031] [188287] (28 PDB entries)
  8. 3086094Domain d7phvc_: 7phv C: [422411]
    automated match to d3wlwd_
    complexed with nh4

Details for d7phvc_

PDB Entry: 7phv (more details), 3.09 Å

PDB Description: pfcyrpa bound to monoclonal antibody cy.007 fab fragment
PDB Compounds: (C:) Monoclonal antibody Cy.007 light chain

SCOPe Domain Sequences for d7phvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7phvc_ b.1.1.0 (C:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
altqpssvsanpgetvkitcsggssdygwyqqkspgsapvtviyennkrpsdipsrfsgs
kfgsthtltitgvqaddeavyfcgsrdtnngafgagttltvlrtvaapsvfifppsdeql
ksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskad
yekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d7phvc_:

Click to download the PDB-style file with coordinates for d7phvc_.
(The format of our PDB-style files is described here.)

Timeline for d7phvc_:

  • d7phvc_ is new in SCOPe 2.08-stable