Lineage for d1tii.1 (1tii A:,C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000539Protein Heat-labile toxin, A-chain [56401] (2 species)
  7. 3000550Species Escherichia coli, type IIB [TaxId:562] [56403] (1 PDB entry)
  8. 3000551Domain d1tii.1: 1tii A:,C: [42238]
    Other proteins in same PDB: d1tiid_, d1tiie_, d1tiif_, d1tiig_, d1tiih_

Details for d1tii.1

PDB Entry: 1tii (more details), 2.25 Å

PDB Description: escherichia coli heat labile enterotoxin type iib
PDB Compounds: (A:) heat labile enterotoxin type iib, (C:) heat labile enterotoxin type iib

SCOPe Domain Sequences for d1tii.1:

Sequence, based on SEQRES records: (download)

>g1tii.1 d.166.1.1 (A:,C:) Heat-labile toxin, A-chain {Escherichia coli, type IIB [TaxId: 562]}
ndyfradsrtpdevrrsggliprgqdeayergtpininlydhargtatgntryndgyvst
tttlrqahllgqnmlggyneyyiyvvaaapnlfdvngvlgryspypseneyaalggipls
qiigwyrvsfgaieggmhrnrdyrrdlfrglsaapnedgyriagfpdgfpaweevpwref
apnsclpXttcasltnklsqhdladfkkyikrkftlmtllsinn

Sequence, based on observed residues (ATOM records): (download)

>g1tii.1 d.166.1.1 (A:,C:) Heat-labile toxin, A-chain {Escherichia coli, type IIB [TaxId: 562]}
ndyfradsrtpdevrrsggliprgqdeayergtpininlydhargttgntryndgyvstt
ttlrqahllgqnmlggyneyyiyvvaaapnlfdvngvlgryspypseneyaalggiplsq
iigwyrvsfgaieggmhrnrdyrrdlfrglsaapnedgyriagfpdgfpaweevpwrefa
pnsclpXttcasltnklsqhdladfkkyikrkftlmtllsinn

SCOPe Domain Coordinates for d1tii.1:

Click to download the PDB-style file with coordinates for d1tii.1.
(The format of our PDB-style files is described here.)

Timeline for d1tii.1: