Lineage for d7duea_ (7due A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 3086054Species Pseudomonas aeruginosa [TaxId:287] [422371] (1 PDB entry)
  8. 3086055Domain d7duea_: 7due A: [422372]
    automated match to d5o7nb_
    complexed with fmt, hl3, zn

Details for d7duea_

PDB Entry: 7due (more details), 1.8 Å

PDB Description: crystal structure of vim-2 mbl in complex with (r)-1-(sec-butyl)-1h- imidazole-2-carboxylic acid
PDB Compounds: (A:) beta-lactamase class b vim-2

SCOPe Domain Sequences for d7duea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7duea_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr

SCOPe Domain Coordinates for d7duea_:

Click to download the PDB-style file with coordinates for d7duea_.
(The format of our PDB-style files is described here.)

Timeline for d7duea_:

  • d7duea_ is new in SCOPe 2.08-stable