SCOPe 2.08: Domain d7duea_: 7due A:

Lineage for d7duea_ (7due A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families)

5. Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)

6. Protein Zn metallo-beta-lactamase [56283] (14 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [422371] (1 PDB entry)

8. Domain d7duea_: 7due A: [422372]
   automated match to d5o7nb_
   complexed with fmt, hl3, zn

Details for d7duea_

PDB Entry: 7due, 1.8 Å

PDB Description: crystal structure of vim-2 mbl in complex with (r)-1-(sec-butyl)-1h- imidazole-2-carboxylic acid

PDB Compounds: (A:) beta-lactamase class b vim-2

SCOPe Domain Sequences for d7duea_:

Sequence; same for both SEQRES and ATOM records:

>d7duea_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa [TaxId: 287]}
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr

Timeline for d7duea_:

• d7duea_ is new in SCOPe 2.08-stable