Lineage for d1htl.1 (1htl A:,C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85464Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 85465Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 85466Family d.166.1.1: ADP-ribosylating toxins [56400] (7 proteins)
  6. 85494Protein Heat-labile toxin, A-chain [56401] (2 species)
  7. 85495Species Escherichia coli, type IB [TaxId:562] [56402] (9 PDB entries)
  8. 85504Domain d1htl.1: 1htl A:,C: [42237]
    Other proteins in same PDB: d1htld_, d1htle_, d1htlf_, d1htlg_, d1htlh_

Details for d1htl.1

PDB Entry: 1htl (more details), 2.5 Å

PDB Description: mutation of a buried residue causes lack of activity but no conformational change: crystal structure of e. coli heat-labile enterotoxin mutant val 97--> lys

SCOP Domain Sequences for d1htl.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1htl.1 d.166.1.1 (A:,C:) Heat-labile toxin, A-chain {Escherichia coli, type IB}
rlyradsrppdeikrsgglmprghneyfdrgtqmninlydhargtqtgfvryddgyvsts
lslrsahlagqsilsgystyyiyviatapnmfnkndvlgvysphpyeqevsalggipysq
iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlagfppdhqawreepwihha
pqgcgXgdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri

SCOP Domain Coordinates for d1htl.1:

Click to download the PDB-style file with coordinates for d1htl.1.
(The format of our PDB-style files is described here.)

Timeline for d1htl.1: