Lineage for d1ltg.1 (1ltg A:,C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37191Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 37192Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 37193Family d.166.1.1: ADP-ribosylating toxins [56400] (7 proteins)
  6. 37221Protein Heat-labile toxin, A-chain [56401] (2 species)
  7. 37222Species Escherichia coli, type IB [TaxId:562] [56402] (9 PDB entries)
  8. 37229Domain d1ltg.1: 1ltg A:,C: [42235]
    Other proteins in same PDB: d1ltgd_, d1ltge_, d1ltgf_, d1ltgg_, d1ltgh_

Details for d1ltg.1

PDB Entry: 1ltg (more details), 2.4 Å

PDB Description: the arg7lys mutant of heat-labile enterotoxin exhibits great flexibility of active site loop 47-56 of the a subunit

SCOP Domain Sequences for d1ltg.1:

Sequence, based on SEQRES records: (download)

>g1ltg.1 d.166.1.1 (A:,C:) Heat-labile toxin, A-chain {Escherichia coli, type IB}
rlykadsrppdeikrsgglmprghneyfdrgtqmninlydhargtqtgfvryddgyvsts
lslrsahlagqsilsgystyyiyviatapnmfnvndvlgvysphpyeqevsalggipysq
iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlagfppdhqawreepwihha
pqgcgXgdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri

Sequence, based on observed residues (ATOM records): (download)

>g1ltg.1 d.166.1.1 (A:,C:) Heat-labile toxin, A-chain {Escherichia coli, type IB}
rlykadsrppdeikrsgglmprghneyfdrgtqmninlydhardgyvstslslrsahlag
qsilsgystyyiyviatapnmfnvndvlgvysphpyeqevsalggipysqiygwyrvnfg
viderlhrnreyrdryyrnlniapaedgyrlagfppdhqawreepwihhapqgcgXgdtc
neetqnlstiylreyqskvkrqifsdyqsevdiynri

SCOP Domain Coordinates for d1ltg.1:

Click to download the PDB-style file with coordinates for d1ltg.1.
(The format of our PDB-style files is described here.)

Timeline for d1ltg.1: