![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Activated CDC42 kinase 1, ACK1 [111200] (1 species) PTK group; Tck subfamily; non-membrane spanning protein tyrosine kinase |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111201] (11 PDB entries) Uniprot Q07912 117-389 |
![]() | Domain d7kp6b_: 7kp6 B: [422342] automated match to d1u54a_ complexed with cl, wtp |
PDB Entry: 7kp6 (more details), 1.79 Å
SCOPe Domain Sequences for d7kp6b_:
Sequence, based on SEQRES records: (download)
>d7kp6b_ d.144.1.7 (B:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclkpdvlsqpeamddfir evnamhsldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqv aegmgyleskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmqehrkvpfaw capeslktrtfshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedc pqdiynvmvqcwahkpedrptfvalrdflleaqpt
>d7kp6b_ d.144.1.7 (B:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} ltcligekdlrlleklgdgsfgvvrrgewdapsgktvsvavkclqpeamddfirevnamh sldhrnlirlygvvltppmkmvtelaplgslldrlrkhqghfllgtlsryavqvaegmgy leskrfihrdlaarnlllatrdlvkigdfglmralpqnddhyvmkvpfawcapeslktrt fshasdtwmfgvtlwemftygqepwiglngsqilhkidkegerlprpedcpqdiynvmvq cwahkpedrptfvalrdflleaqpt
Timeline for d7kp6b_: