Lineage for d1lti.1 (1lti A:,C:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 877625Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 877626Superfamily d.166.1: ADP-ribosylation [56399] (7 families) (S)
  5. 877627Family d.166.1.1: ADP-ribosylating toxins [56400] (9 proteins)
  6. 877741Protein Heat-labile toxin, A-chain [56401] (2 species)
  7. 877742Species Escherichia coli, type IB [TaxId:562] [56402] (9 PDB entries)
  8. 877747Domain d1lti.1: 1lti A:,C: [42233]
    Other proteins in same PDB: d1ltid_, d1ltie_, d1ltif_, d1ltig_, d1ltih_
    complexed with gal, nga

Details for d1lti.1

PDB Entry: 1lti (more details), 2.13 Å

PDB Description: heat-labile enterotoxin (lt-i) complex with t-antigen
PDB Compounds: (A:) heat labile enterotoxin type I, (C:) heat labile enterotoxin type I

SCOP Domain Sequences for d1lti.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1lti.1 d.166.1.1 (A:,C:) Heat-labile toxin, A-chain {Escherichia coli, type IB [TaxId: 562]}
rlyradsrppdeikrsgglmprghneyfdrgtqmninlydhargtqtgfvryddgyvsts
lslrsahlagqsilsgystyyiyviatapnmfnvndvlgvysphpyeqevsalggipysq
iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlagfppdhqawreepwihha
pqgcgXgdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri

SCOP Domain Coordinates for d1lti.1:

Click to download the PDB-style file with coordinates for d1lti.1.
(The format of our PDB-style files is described here.)

Timeline for d1lti.1: