Lineage for d1lt3a_ (1lt3 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37191Fold d.166: ADP-ribosylation [56398] (1 superfamily)
  4. 37192Superfamily d.166.1: ADP-ribosylation [56399] (2 families) (S)
  5. 37193Family d.166.1.1: ADP-ribosylating toxins [56400] (7 proteins)
  6. 37221Protein Heat-labile toxin, A-chain [56401] (2 species)
  7. 37222Species Escherichia coli, type IB [TaxId:562] [56402] (9 PDB entries)
  8. 37224Domain d1lt3a_: 1lt3 A: [42230]
    Other proteins in same PDB: d1lt3d_, d1lt3e_, d1lt3f_, d1lt3g_, d1lt3h_

Details for d1lt3a_

PDB Entry: 1lt3 (more details), 2 Å

PDB Description: heat-labile enterotoxin double mutant n40c/g166c

SCOP Domain Sequences for d1lt3a_:

Sequence, based on SEQRES records: (download)

>d1lt3a_ d.166.1.1 (A:) Heat-labile toxin, A-chain {Escherichia coli, type IB}
rlyradsrppdeikrsgglmprghneyfdrgtqmniclydhargtqtgfvryddgyvsts
lslrsahlagqsilsgystyyiyviatapnmfnvndvlgvysphpyeqevsalggipysq
iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlacfppdhqawreepwihha
pqgcgnssrtitgdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri

Sequence, based on observed residues (ATOM records): (download)

>d1lt3a_ d.166.1.1 (A:) Heat-labile toxin, A-chain {Escherichia coli, type IB}
rlyradsrppdeikrsgglmprghneyfdrgtqmniclydhargtqtgfvryddgyvsts
lslrsahlagqsilsgystyyiyviatapnmfnvndvlgvysphpyeqevsalggipysq
iygwyrvnfgviderlhrnreyrdryyrnlniapaedgyrlacfppdhqawreepwihha
pqgcggdtcneetqnlstiylreyqskvkrqifsdyqsevdiynri

SCOP Domain Coordinates for d1lt3a_:

Click to download the PDB-style file with coordinates for d1lt3a_.
(The format of our PDB-style files is described here.)

Timeline for d1lt3a_: