Lineage for d1hwna_ (1hwn A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2605978Protein Ebulin A-chain [56391] (1 species)
  7. 2605979Species Sambucus ebulus [TaxId:28503] [56392] (4 PDB entries)
  8. 2605981Domain d1hwna_: 1hwn A: [42224]
    Other proteins in same PDB: d1hwnb1, d1hwnb2
    complexed with gal, nag

Details for d1hwna_

PDB Entry: 1hwn (more details), 2.8 Å

PDB Description: ebulin complexed with galactose, trigonal crystal form
PDB Compounds: (A:) ebulin

SCOPe Domain Sequences for d1hwna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwna_ d.165.1.1 (A:) Ebulin A-chain {Sambucus ebulus [TaxId: 28503]}
idypsvsfnlagaksttyrdflknlrdrvatgtyevnglpvlrresevqvknrfvlvrlt
nyngdtvtsavdvtnlylvafsangnsyffkdatelqksnlflgttqhtlsftgnydnle
taagtrresielgpnpldgaitslwydggvarsllvliqmvpeaarfryieqevrrslqq
ltsftpnalmlsmennwssmslevqlsgdnvspfsgtvqlqnydhtprlvdnfeelykit
giaillfrcvatkt

SCOPe Domain Coordinates for d1hwna_:

Click to download the PDB-style file with coordinates for d1hwna_.
(The format of our PDB-style files is described here.)

Timeline for d1hwna_: