Lineage for d7s6rf_ (7s6r F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703608Protein automated matches [190435] (12 species)
    not a true protein
  7. 2703703Species Methylosinus trichosporium [TaxId:595536] [392644] (12 PDB entries)
  8. 3085887Domain d7s6rf_: 7s6r F: [422204]
    Other proteins in same PDB: d7s6rc_, d7s6rd_, d7s6rg_, d7s6rh_
    automated match to d6vk5b_
    complexed with bez, edo, fe; mutant

Details for d7s6rf_

PDB Entry: 7s6r (more details), 1.89 Å

PDB Description: complex structure of methane monooxygenase hydroxylase and regulatory subunit with h5a mutation
PDB Compounds: (F:) Methane monooxygenase beta chain

SCOPe Domain Sequences for d7s6rf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7s6rf_ a.25.1.2 (F:) automated matches {Methylosinus trichosporium [TaxId: 595536]}
pqssqvtkrgltdperaaiiaaavpdhaldtqrkyhyfiqprwkrlseyeqlscyaqpnp
dwiaggldwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearyt
qrflaayssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtav
faaldkvdnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqd
wneilwaghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfv
yclandsefgahnrtflnawtehylassvaalkdfvglyakvekvagatdragvsealqr
vfgdwkidyadkigfrvdvdqkvdavlagykn

SCOPe Domain Coordinates for d7s6rf_:

Click to download the PDB-style file with coordinates for d7s6rf_.
(The format of our PDB-style files is described here.)

Timeline for d7s6rf_:

  • d7s6rf_ is new in SCOPe 2.08-stable