Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins) |
Protein automated matches [190435] (12 species) not a true protein |
Species Methylosinus trichosporium [TaxId:595536] [392644] (12 PDB entries) |
Domain d7s6rf_: 7s6r F: [422204] Other proteins in same PDB: d7s6rc_, d7s6rd_, d7s6rg_, d7s6rh_ automated match to d6vk5b_ complexed with bez, edo, fe; mutant |
PDB Entry: 7s6r (more details), 1.89 Å
SCOPe Domain Sequences for d7s6rf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7s6rf_ a.25.1.2 (F:) automated matches {Methylosinus trichosporium [TaxId: 595536]} pqssqvtkrgltdperaaiiaaavpdhaldtqrkyhyfiqprwkrlseyeqlscyaqpnp dwiaggldwgdwtqkfhggrpswgnestelrttdwyrhrdparrwhhpyvkdkseearyt qrflaayssegsirtidpywrdeilnkyfgallyseyglfnahssvgrdclsdtirqtav faaldkvdnaqmiqmerlfiaklvpgfdastdvpkkiwttdpiysgaratvqeiwqgvqd wneilwaghavydatfgqfarreffqrlatvygdtltpfftaqsqtyfqttrgaiddlfv yclandsefgahnrtflnawtehylassvaalkdfvglyakvekvagatdragvsealqr vfgdwkidyadkigfrvdvdqkvdavlagykn
Timeline for d7s6rf_: