Lineage for d2aaia_ (2aai A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 613902Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 613903Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 613904Family d.165.1.1: Plant cytotoxins [56372] (15 proteins)
  6. 613994Protein Ricin A-chain [56389] (1 species)
  7. 613995Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (19 PDB entries)
  8. 614009Domain d2aaia_: 2aai A: [42219]
    Other proteins in same PDB: d2aaib1, d2aaib2
    complexed with gal, glc, man, nag

Details for d2aaia_

PDB Entry: 2aai (more details), 2.5 Å

PDB Description: crystallographic refinement of ricin to 2.5 angstroms

SCOP Domain Sequences for d2aaia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aaia_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis)}
ifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilv
elsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafg
gnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaar
fqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskf
svydvsilipiialmvyrcapppssqf

SCOP Domain Coordinates for d2aaia_:

Click to download the PDB-style file with coordinates for d2aaia_.
(The format of our PDB-style files is described here.)

Timeline for d2aaia_: