Lineage for d7pbig2 (7pbi G:240-527)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955209Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955316Family d.58.32.0: automated matches [227166] (1 protein)
    not a true family
  6. 2955317Protein automated matches [226875] (6 species)
    not a true protein
  7. 3085780Species Gulosibacter chungangensis [TaxId:979746] [422097] (1 PDB entry)
  8. 3085870Domain d7pbig2: 7pbi G:240-527 [422187]
    Other proteins in same PDB: d7pbia1, d7pbib1, d7pbic1, d7pbid1, d7pbie1, d7pbif1, d7pbig1, d7pbih1
    automated match to d5fxda2
    complexed with fad, h7y

Details for d7pbig2

PDB Entry: 7pbi (more details), 2.8 Å

PDB Description: 4-ethylphenol oxidase from gulosibacter chungangensis: isoeugenol complex
PDB Compounds: (G:) FAD-binding oxidoreductase

SCOPe Domain Sequences for d7pbig2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7pbig2 d.58.32.0 (G:240-527) automated matches {Gulosibacter chungangensis [TaxId: 979746]}
pemlsfaiyfeneddlpaimettlplrigmaplqaapivrnvtfdaacvskreewqtepg
pltdeakqrmvdelgighwivygtcygprwqidkyiemirdaylqipgarfetnetlplr
egdrasellnarhelntgvpnrhsaavfdwfpnaghffyapvsapsgedaakqyedtkri
sddhgidylaqfiiglremhhiclplydtadpasrketldmtreliragaeegygiyrah
nvladqvaetysfnnhiqrrsherikdaldpngilnpgksgiwperlr

SCOPe Domain Coordinates for d7pbig2:

Click to download the PDB-style file with coordinates for d7pbig2.
(The format of our PDB-style files is described here.)

Timeline for d7pbig2:

  • d7pbig2 is new in SCOPe 2.08-stable