Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries) |
Domain d7ontb2: 7ont B:797-1011 [422183] Other proteins in same PDB: d7onta1, d7ontb1 automated match to d4hhyd2 complexed with so4, vkq |
PDB Entry: 7ont (more details), 1.85 Å
SCOPe Domain Sequences for d7ontb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ontb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllklkfnfkt
Timeline for d7ontb2: