Lineage for d7ontb2 (7ont B:797-1011)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000733Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 3000734Protein automated matches [191197] (13 species)
    not a true protein
  7. 3000809Species Human (Homo sapiens) [TaxId:9606] [225406] (56 PDB entries)
  8. 3085866Domain d7ontb2: 7ont B:797-1011 [422183]
    Other proteins in same PDB: d7onta1, d7ontb1
    automated match to d4hhyd2
    complexed with so4, vkq

Details for d7ontb2

PDB Entry: 7ont (more details), 1.85 Å

PDB Description: parp1 catalytic domain in complex with a selective pyridine carboxamide-based inhibitor (compound 22)
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d7ontb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ontb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d7ontb2:

Click to download the PDB-style file with coordinates for d7ontb2.
(The format of our PDB-style files is described here.)

Timeline for d7ontb2:

  • d7ontb2 is new in SCOPe 2.08-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d7ontb1