SCOPe 2.03: Domain d1obta_: 1obt A:

Lineage for d1obta_ (1obt A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein Ricin A-chain [56389] (1 species)

7. Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (36 PDB entries)
   Uniprot P06750 28-286

8. Domain d1obta_: 1obt A: [42216]
   complexed with amp; mutant

Details for d1obta_

PDB Entry: 1obt, 2.8 Å

PDB Description: structure of ricin a chain mutant, complex with amp

PDB Compounds: (A:) ricin a chain

SCOPe Domain Sequences for d1obta_:

Sequence; same for both SEQRES and ATOM records:

>d1obta_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
ypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsnh
aelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnydr
leqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaahfqyie
gemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvydv
silipiialmvyrcappp

Timeline for d1obta_:

• d1obta_ first appeared (with stable ids) in SCOP 1.55, called d1obt__
  
• d1obta_ appears in SCOPe 2.02
  
• d1obta_ appears in SCOPe 2.04
  
• d1obta_ appears in the current release, SCOPe 2.08