SCOP 1.65: Domain d1obt__: 1obt -

Lineage for d1obt__ (1obt -)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (12 proteins)

6. Protein Ricin A-chain [56389] (1 species)

7. Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (15 PDB entries)

8. Domain d1obt__: 1obt - [42216]
   complexed with amp; mutant

Details for d1obt__

PDB Entry: 1obt, 2.8 Å

PDB Description: structure of ricin a chain mutant, complex with amp

SCOP Domain Sequences for d1obt__:

Sequence; same for both SEQRES and ATOM records:

>d1obt__ d.165.1.1 (-) Ricin A-chain {Castor bean (Ricinus communis)}
ypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsnh
aelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnydr
leqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaahfqyie
gemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvydv
silipiialmvyrcappp

Timeline for d1obt__:

• d1obt__ first appeared (with stable ids) in SCOP 1.55
  
• d1obt__ appears in SCOP 1.63
  
• d1obt__ appears in SCOP 1.67
  
• d1obt__ appears in the current release, SCOPe 2.08, called d1obta_