SCOPe 2.08: Domain d7rbsa1: 7rbs A:3-61

Lineage for d7rbsa1 (7rbs A:3-61)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383234] (35 PDB entries)

8. Domain d7rbsa1: 7rbs A:3-61 [422157]
   Other proteins in same PDB: d7rbsa2, d7rbsb2, d7rbsb3, d7rbsc2, d7rbsd2, d7rbsd3, d7rbse2, d7rbsf2, d7rbsf3, d7rbsg2, d7rbsh2, d7rbsh3, d7rbsi2, d7rbsj2, d7rbsj3
   automated match to d6wrha1
   complexed with zn; mutant

Details for d7rbsa1

PDB Entry: 7rbs, 2.98 Å

PDB Description: the crystal structure of papain-like protease of sars cov-2, c111s mutant, in complex with human isg15

PDB Compounds: (A:) papain-like protease

SCOPe Domain Sequences for d7rbsa1:

Sequence; same for both SEQRES and ATOM records:

>d7rbsa1 d.15.1.0 (A:3-61) automated matches {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
rtikvfttvdninlhtqvvdmsmtygqqfgptyldgadvtkikphnshegktfyvlpnd

Timeline for d7rbsa1:

• d7rbsa1 is new in SCOPe 2.08-stable