SCOPe 2.08: Domain d7mh5l_: 7mh5 L:

Lineage for d7mh5l_ (7mh5 L:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (68 PDB entries)
   Uniprot P02954

8. Domain d7mh5l_: 7mh5 L: [422154]
   Other proteins in same PDB: d7mh5m_
   automated match to d1qovl_
   complexed with bcl, bph, cdl, fe, lda, spo, tyi, u10

Details for d7mh5l_

PDB Entry: 7mh5, 2.85 Å

PDB Description: crystal structure of r. sphaeroides photosynthetic reaction center variant; y(m210)3-iodotyrosine

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d7mh5l_:

Sequence; same for both SEQRES and ATOM records:

>d7mh5l_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d7mh5l_:

• d7mh5l_ is new in SCOPe 2.08-stable