Lineage for d1ifu__ (1ifu -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) 
Family d.165.1.1: Plant cytotoxins [56372] (11 proteins) 
Protein Ricin A-chain [56389] (1 species) Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (11 PDB entries) 
Domain d1ifu__: 1ifu - [42215]
Details for d1ifu__
PDB Entry: 1ifu (more details), 2.4 Å
PDB Description: ricin a-chain (recombinant) complex with formycin
SCOP Domain Sequences for d1ifu__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ifu__ d.165.1.1 (-) Ricin A-chain {Castor bean (Ricinus communis)}
ypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvelsnh
aelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggnydr
leqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqyie
gemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvydv
silipiialmvyrcappp
SCOP Domain Coordinates for d1ifu__:
Click to download the PDB-style file with coordinates for d1ifu__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ifu__:
- d1ifu__ first appeared (with stable ids) in SCOP 1.55
- d1ifu__ appears in SCOP 1.59
- d1ifu__ appears in the current release, SCOPe 2.08, called d1ifua_
View in 3D