Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) |
Family d.41.3.0: automated matches [254277] (1 protein) not a true family |
Protein automated matches [254643] (6 species) not a true protein |
Species Parageobacillus thermoglucosidasius [TaxId:1426] [422145] (1 PDB entry) |
Domain d7m7kb3: 7m7k B:331-433 [422146] Other proteins in same PDB: d7m7kb1, d7m7kb2, d7m7kb4 automated match to d1brwa3 complexed with so4, uri |
PDB Entry: 7m7k (more details), 1.89 Å
SCOPe Domain Sequences for d7m7kb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7m7kb3 d.41.3.0 (B:331-433) automated matches {Parageobacillus thermoglucosidasius [TaxId: 1426]} qakyrweleapedgyvaeivadevgtaamllgagratkeatidlsvglvlhkkvgdavkk geslvtiysntenieevkqklaksirlssipvakptliyetis
Timeline for d7m7kb3: