Lineage for d7m7kb3 (7m7k B:331-433)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945237Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2945255Family d.41.3.0: automated matches [254277] (1 protein)
    not a true family
  6. 2945256Protein automated matches [254643] (6 species)
    not a true protein
  7. 3085828Species Parageobacillus thermoglucosidasius [TaxId:1426] [422145] (1 PDB entry)
  8. 3085829Domain d7m7kb3: 7m7k B:331-433 [422146]
    Other proteins in same PDB: d7m7kb1, d7m7kb2, d7m7kb4
    automated match to d1brwa3
    complexed with so4, uri

Details for d7m7kb3

PDB Entry: 7m7k (more details), 1.89 Å

PDB Description: crystal structure of uridine bound to geobacillus thermoglucosidasius pyrimidine nucleoside phosphorylase pynp
PDB Compounds: (B:) Pyrimidine-nucleoside phosphorylase

SCOPe Domain Sequences for d7m7kb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7m7kb3 d.41.3.0 (B:331-433) automated matches {Parageobacillus thermoglucosidasius [TaxId: 1426]}
qakyrweleapedgyvaeivadevgtaamllgagratkeatidlsvglvlhkkvgdavkk
geslvtiysntenieevkqklaksirlssipvakptliyetis

SCOPe Domain Coordinates for d7m7kb3:

Click to download the PDB-style file with coordinates for d7m7kb3.
(The format of our PDB-style files is described here.)

Timeline for d7m7kb3:

  • d7m7kb3 is new in SCOPe 2.08-stable