Lineage for d1br6a_ (1br6 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. Protein Ricin A-chain [56389] (1 species)
  7. Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (54 PDB entries)
    Uniprot P06750 28-286
  8. Domain d1br6a_: 1br6 A: [42214]
    complexed with pt1

Details for d1br6a_

PDB Entry: 1br6 (more details), 2.3 Å

PDB Description: ricin a chain (recombinant) complex with pteroic acid
PDB Compounds: (A:) protein (ricin)

SCOPe Domain Sequences for d1br6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1br6a_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
mifpkqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfil
velsnhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfaf
ggnydrleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaa
rfqyiegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngsk
fsvydvsilipiialmvyrcapppssqf

SCOPe Domain Coordinates for d1br6a_ are not available.

Timeline for d1br6a_: