Lineage for d7m72d2 (7m72 D:114-242)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 3085815Domain d7m72d2: 7m72 D:114-242 [422132]
    Other proteins in same PDB: d7m72b_, d7m72c2
    automated match to d6eh4e2
    complexed with hp6, qod

Details for d7m72d2

PDB Entry: 7m72 (more details), 2.4 Å

PDB Description: mhc-like protein complex structure
PDB Compounds: (D:) NKT Vbeta8.2 (Mouse)-2C12 TCR,Human nkt tcr beta chain

SCOPe Domain Sequences for d7m72d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7m72d2 b.1.1.0 (D:114-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

SCOPe Domain Coordinates for d7m72d2:

Click to download the PDB-style file with coordinates for d7m72d2.
(The format of our PDB-style files is described here.)

Timeline for d7m72d2:

  • d7m72d2 is new in SCOPe 2.08-stable