Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein automated matches [190140] (37 species) not a true protein |
Species Escherichia coli [TaxId:562] [189978] (4 PDB entries) |
Domain d7oysa_: 7oys A: [422103] automated match to d6ye8a_ complexed with cl, edo, gol, peg, spd; mutant |
PDB Entry: 7oys (more details), 1.57 Å
SCOPe Domain Sequences for d7oysa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7oysa_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} eqktlhiynwtdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsas flerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkv kavlgenapvdswdlilkpenleklkscgvsflddpeevfatvlnylgkdpnstkaddyt gpatdlllklrpniryfhssqyindlangdicvaigwagsvwqasnrakeakngvnvsfs ipkegamawfdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsa evrenpgiyppadvraklftqkvqdpkidrvrtrawtkvksg
Timeline for d7oysa_: