Lineage for d7oysa_ (7oys A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914680Protein automated matches [190140] (37 species)
    not a true protein
  7. 2914759Species Escherichia coli [TaxId:562] [189978] (4 PDB entries)
  8. 3085786Domain d7oysa_: 7oys A: [422103]
    automated match to d6ye8a_
    complexed with cl, edo, gol, peg, spd; mutant

Details for d7oysa_

PDB Entry: 7oys (more details), 1.57 Å

PDB Description: e.coli's putrescine receptor variant potf/d (4jdf) with mutations e39d y87s in complex with spermidine
PDB Compounds: (A:) Putrescine-binding periplasmic protein

SCOPe Domain Sequences for d7oysa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7oysa_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
eqktlhiynwtdyiapdtvanfeketgikvvydvfdsnevlegklmagstgfdlvvpsas
flerqltagvfqpldksklpewknldpellklvakhdpdnkfampymwattgigynvdkv
kavlgenapvdswdlilkpenleklkscgvsflddpeevfatvlnylgkdpnstkaddyt
gpatdlllklrpniryfhssqyindlangdicvaigwagsvwqasnrakeakngvnvsfs
ipkegamawfdvfampadaknkdeayqflnyllrpdvvahisdhvfyanankaatplvsa
evrenpgiyppadvraklftqkvqdpkidrvrtrawtkvksg

SCOPe Domain Coordinates for d7oysa_:

Click to download the PDB-style file with coordinates for d7oysa_.
(The format of our PDB-style files is described here.)

Timeline for d7oysa_:

  • d7oysa_ is new in SCOPe 2.08-stable