Lineage for d7nybb_ (7nyb B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894326Family c.66.1.53: TrmB-like [142647] (2 proteins)
    Pfam PF02390
  6. 3085756Protein automated matches [422073] (1 species)
    not a true protein
  7. 3085757Species Bacillus subtilis [TaxId:224308] [422074] (1 PDB entry)
  8. 3085771Domain d7nybb_: 7nyb B: [422088]
    automated match to d2fcaa1
    protein/RNA complex; complexed with sam

Details for d7nybb_

PDB Entry: 7nyb (more details), 2.5 Å

PDB Description: trmb complex with sam
PDB Compounds: (B:) tRNA (guanine-N(7)-)-methyltransferase

SCOPe Domain Sequences for d7nybb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7nybb_ c.66.1.53 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
ddflaenadiaisnpadykgkwntvfgndnpihievgtgkgqfisgmakqnpdinyigie
lfksvivtavqkvkdseaqnvkllnidadtltdvfepgevkrvylnfsdpwpkkrhekrr
ltyshflkkyeevmgkggsihfktdnrglfeyslksfseygllltyvsldlhnsnlegni
mteyeekfsalgqpiyraevewrt

SCOPe Domain Coordinates for d7nybb_:

Click to download the PDB-style file with coordinates for d7nybb_.
(The format of our PDB-style files is described here.)

Timeline for d7nybb_:

  • d7nybb_ is new in SCOPe 2.08-stable